Total number of results for Squalus acanthias are 4
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP04066 |
SMEHFRWGKPM
|
11 | Squalus acanthias | Opioid | Melanocyte stimulating hormones | 5476715#Lowry PJ, Chadwick A#Purification and amino acid sequence of melanocyte-stimulating hormone from the dogfish Squalus acanthias#Biochem J 1970 Aug;118(5):713-8 | |
| NP04715 |
SYSMEHFRWGKPMGRKRRPIKVYPNSFEDESVENMGPEL
|
39 | Squalus acanthias | POMC | adrenocorticotrophic hormone | 4375977#Lowry PJ, Bennett HP, McMartin C#The isolation and amino acid sequence of an adrenocorticotrophin from the pars distalis and a corticotrophin-like intermediate-lobe peptide from the neurointermediate lobe of the pituitary of the dogfish Squalus acanthias#Biochem J 1974 Aug;141(2):427-37 | |
| NP04848 |
SYSMEHFRWGKPM
|
13 | Squalus acanthias | POMC | Melanotropin alpha | 4375977#Lowry P.J., Bennett H.P.J., McMartin C., Scott A.P.#The isolation and amino acid sequence of an adrenocorticotrophin from the pars distalis and a corticotrophin-like intermediate-lobe peptide from the neurointermediate lobe of the pituitary of the dogfish Squalus acanthias.# Biochem. J. 141:427-437(1974).$5476715#Lowry P.J., Chadwick A.#Purification and amino acid sequence of melanocyte-stimulating hormone from the dogfish Squalus acanthias.#Biochem. J. 118:713-718(1970). | |
| NP04849 |
PIKVYPNSFEDESVENMGPEL
|
21 | Squalus acanthias | POMC | Corticotropin-like intermediary peptide |